PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi07g03280.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 400aa    MW: 44200.2 Da    PI: 8.4787
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi07g03280.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.91.9e-32257312156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k+r++W+peLH+rFv+a+++LGGs+ AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Vradi07g03280.1 257 KQRRCWSPELHRRFVNALQKLGGSQAATPKQIRELMQVDGLTNDEVKSHLQKYRLH 312
                      79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.73E-18254315IPR009057Homeodomain-like
PROSITE profilePS5129414.461254314IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-29255315IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-27257312IPR006447Myb domain, plants
PfamPF002494.0E-8259310IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MGSVLPELSL DLRPSFVPKT ITDFLRHLSS ATDRLATLHD FLARLEDELR KIHAFKRELP  60
LSMLLLNDAI SLLKTESQKC GPPDSSPVLE EFIPLKKEYD RNEGNNSNDN DMDNECRDKK  120
NWLSSVQLWN NSTTASDRKH QQLHTLENKK IEEGQYVGED PFQSCSNING GRRAFLPFSR  180
YSSSSSSVPV ATAGLAAATK EEKEESVMNR LSLQNPSVKE GCGSRGSRSS SNRAVSSSPP  240
TVHPSLRASS LQQTARKQRR CWSPELHRRF VNALQKLGGS QAATPKQIRE LMQVDGLTND  300
EVKSHLQKYR LHTRRVPAGS GNQPVVVLGG LWMSQDQYND SSKVSSSGSG SPQSPLHLTT  360
GSRGGTSPTE GDSMEDDEDA RSESYSWKSH MHKPGKVDV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014510738.10.0PREDICTED: uncharacterized protein LOC106769578
TrEMBLA0A0L9TP830.0A0A0L9TP83_PHAAN; Uncharacterized protein
TrEMBLA0A0S3R3I40.0A0A0S3R3I4_PHAAN; Uncharacterized protein
STRINGGLYMA07G33130.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.17e-53G2-like family protein